- TRIM40 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-92530
- 0.1 ml (also 25ul)
- Immunohistochemistry, Immunohistochemistry-Paraffin
- Rabbit
- Unconjugated
- Human
- This antibody was developed against Recombinant Protein corresponding to amino acids: QQWLGQLEHM PAEAARILDI SRAVTQLRSL VIDLERTAKE LDTNTLKNAG DLLNRSAPQK LEVIYPQLEK GVSELLLQP
- TRIM40
- RNF35
- PBS (pH 7.2) and 40% Glycerol
- tripartite motif containing 40
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Zinc Finger
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
- Primary Antibodies
Sequence
QQWLGQLEHMPAEAARILDISRAVTQLRSLVIDLERTAKELDTNTLKNAGDLLNRSAPQKLEVIYPQLEKGVSELLLQP
Specifications/Features
Available conjugates: Unconjugated